PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10020085
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 329aa    MW: 36981.2 Da    PI: 6.7879
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10020085genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.37.2e-181663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+d+++++G g+W+t +   g+ R++k+c++rw +yl
      Lus10020085 16 KGPWTPEEDQKLIDYIQLHGYGNWRTLPLNAGLQRCGKSCRLRWTNYL 63
                     79********************************************97 PP

2Myb_DNA-binding48.52.1e-1569113147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++  l ++ W++Ia++++ gRt++++k++w+++
      Lus10020085  69 RGRFSFEEEEAIIQLHGILRNK-WSAIASRLP-GRTDNEIKNYWNTH 113
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.6E-24966IPR009057Homeodomain-like
PROSITE profilePS5129424.6011167IPR017930Myb domain
SuperFamilySSF466892.83E-3013110IPR009057Homeodomain-like
SMARTSM007171.1E-121565IPR001005SANT/Myb domain
PfamPF002497.0E-161663IPR001005SANT/Myb domain
CDDcd001676.02E-121863No hitNo description
Gene3DG3DSA:1.10.10.601.5E-2467118IPR009057Homeodomain-like
SMARTSM007176.9E-1568116IPR001005SANT/Myb domain
PROSITE profilePS5129419.0468118IPR017930Myb domain
PfamPF002491.1E-1369113IPR001005SANT/Myb domain
CDDcd001671.49E-1171114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MGRSPLRTCE KNGLKKGPWT PEEDQKLIDY IQLHGYGNWR TLPLNAGLQR CGKSCRLRWT  60
NYLRPDIKRG RFSFEEEEAI IQLHGILRNK WSAIASRLPG RTDNEIKNYW NTHIRKRLLR  120
MGIDPVTHNP RLDLLDLSAI LGSSFSSSQP NISRLLCLVN PEILHLATSL VSSSSSPETQ  180
LQNQTQTQTG GIYDQHYQPM VNPEFQDMTA TTLATTATIT NVPRVEVGPS DNWQRSYTSD  240
SYNDHLHDYY PGTSSFDDHQ TGNTIMDLSA AAASVFSTPS SSPTRLNSNS TLNNFNAGSS  300
TEDERDSYCS NMLRFEMPPS ILDVSNFM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27141185108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX1744480.0JX174448.1 Linum usitatissimum clone LuBAC395P20, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012091477.11e-123PREDICTED: transcription factor MYB3-like
TrEMBLA0A067JDN51e-123A0A067JDN5_JATCU; MYB family protein
STRINGGLYMA15G07230.11e-116(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85034127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.11e-100MYB-like 102